PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA93G00023
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 724aa    MW: 79106.8 Da    PI: 6.5907
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA93G00023genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.52.9e-13222283162
                 XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                 e++ k+  r+++NRe+A+ sRqRKk ++eeLeekv ++ +  ++L  +++    e a+l+++
  AA93G00023 222 EEDEKKKARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITDLNTKISYFMAENATLRQQ 283
                 678899********************************************999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.8E-16222286IPR004827Basic-leucine zipper domain
PfamPF001703.1E-11223284IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.461224284IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.0E-11226284No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-16226285No hitNo description
CDDcd147041.04E-21227278No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 724 aa     Download sequence    Send to blast
MSEDDPPPPS DLNPSFPSDF DSISIPPFDD FCNSGSDQTP IADLMTDLGF PLDANGDFEL  60
TFDGVDELYF PSENETFLIP VNASNQEQFG DFTPDSEGSG ISGDCVVKDA EKKNIDSLPS  120
TSGCCNKESP MDSDDRCLDL PTPLSSQGSG NCGSDVSENT NTSSPKSGNV VVDQKVKVEE  180
AVTTSITKRK KKESDEDMSD ESRNSKYRRS GEEADASVLT GEEDEKKKAR LMRNRESAQL  240
SRQRKKHYVE ELEEKVRNMH STITDLNTKI SYFMAENATL RQQLGNNGMC PPHHQPPPLG  300
MYPPIPYPWM PCPPYMIKQQ GSQVPLIPIP RLKPQNPIGS SKAKKSESKK SESKTKKVAS  360
ISFLGLLFCL VLFGALAPIL NVNYGGISGA LYGNYRSNYI TDMIYDQHRE RVLDSSRYST  420
GTRFSNMKRV NCVKDSDFGG PGKNGSVTES SIPYGNGSEP LVASLFVPRN DKLVKIDGNL  480
IIHSILAGEK ALASQKKASE SKEMKTDLMI SKDFSPALPL SDSVRSGDVA KHPYSSKSEK  540
PKALSSVSAD TLKDQIKTTA ANGKMQQWFR EGVAGPMFSS GMCTEVFQFD VSSTSGAIIP  600
ASPGTNITSK HNKNTTQTHK GKNRRILRSR LPIPLPGSDF NLTKEHQRNN NSNKENFREI  660
KPASSMVVSV LIDPRESGDG GDIDGMISGT KSLSRVFVVV LMDSAKYVTY SCSLPRSGGP  720
PHLV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411360.10.0hypothetical protein EUTSA_v10016317mg
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLV4MJL00.0V4MJL0_EUTSA; Uncharacterized protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein